Lineage for d1lxma4 (1lxm A:620-911)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2044543Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2044682Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2044893Family b.30.5.2: Hyaluronate lyase-like, central domain [50006] (4 protein domains)
    automatically mapped to Pfam PF02278
  6. 2044911Protein Hyaluronate lyase [50009] (2 species)
  7. 2044932Species Streptococcus agalactiae [TaxId:1311] [69241] (3 PDB entries)
  8. 2044935Domain d1lxma4: 1lxm A:620-911 [78299]
    Other proteins in same PDB: d1lxma1, d1lxma2, d1lxma3

Details for d1lxma4

PDB Entry: 1lxm (more details), 2.2 Å

PDB Description: Crystal Structure of Streptococcus agalactiae Hyaluronate Lyase Complexed with Hexasaccharide Unit of Hyaluronan
PDB Compounds: (A:) hyaluronate lyase

SCOPe Domain Sequences for d1lxma4:

Sequence, based on SEQRES records: (download)

>d1lxma4 b.30.5.2 (A:620-911) Hyaluronate lyase {Streptococcus agalactiae [TaxId: 1311]}
lksnlstfnsmdrlayynakkdfgfalslhskrtlnyegmndentrgwytgdgmfyiyns
dqshysnhfwptvnpykmagttekdakredttkefmskhskdakektgqvtgtsdfvgsv
klndhfalaamdftnwdrtltaqkgwvilndkivflgsnikntngignvsttidqrkdds
ktpyttyvngktidlkqassqqftdtksvfleskepgrnigyiffknstidierkeqtgt
wnsinrtskntsivsnpfitisqkhdnkgdsygymmvpnidrtsfdklansk

Sequence, based on observed residues (ATOM records): (download)

>d1lxma4 b.30.5.2 (A:620-911) Hyaluronate lyase {Streptococcus agalactiae [TaxId: 1311]}
lksnlstfnsmdrlayynakkdfgfalslhskrtlnyegmndentrgwytgdgmfyiyns
dqshysnhfwptvnpykmagttekdakredttkeakektgqvtgtsdfvgsvklndhfal
aamdftnwdrtltaqkgwvilndkivflgsnikntngignvsttidqrkddsktpyttyv
ngktisqqftdtksvfleskepgrnigyiffknstidierkeqtgtwnsinrtskntsiv
snpfitisqkhdsygymmvpnidrtsfdklansk

SCOPe Domain Coordinates for d1lxma4:

Click to download the PDB-style file with coordinates for d1lxma4.
(The format of our PDB-style files is described here.)

Timeline for d1lxma4: