Lineage for d1lxma4 (1lxm A:620-919)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 227198Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 227254Superfamily b.30.5: Galactose mutarotase-like [74650] (5 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 227382Family b.30.5.2: Hyaluronate lyase-like, central domain [50006] (2 proteins)
  6. 227390Protein Hyaluronate lyase [50009] (2 species)
  7. 227391Species Streptococcus agalactiae [TaxId:1311] [69241] (3 PDB entries)
  8. 227394Domain d1lxma4: 1lxm A:620-919 [78299]
    Other proteins in same PDB: d1lxma1, d1lxma2, d1lxma3
    complexed with gcu, nag

Details for d1lxma4

PDB Entry: 1lxm (more details), 2.2 Å

PDB Description: Crystal Structure of Streptococcus agalactiae Hyaluronate Lyase Complexed with Hexasaccharide Unit of Hyaluronan

SCOP Domain Sequences for d1lxma4:

Sequence, based on SEQRES records: (download)

>d1lxma4 b.30.5.2 (A:620-919) Hyaluronate lyase {Streptococcus agalactiae}
lksnlstfnsmdrlayynakkdfgfalslhskrtlnyegmndentrgwytgdgmfyiyns
dqshysnhfwptvnpykmagttekdakredttkefmskhskdakektgqvtgtsdfvgsv
klndhfalaamdftnwdrtltaqkgwvilndkivflgsnikntngignvsttidqrkdds
ktpyttyvngktidlkqassqqftdtksvfleskepgrnigyiffknstidierkeqtgt
wnsinrtskntsivsnpfitisqkhdnkgdsygymmvpnidrtsfdklanskevellens

Sequence, based on observed residues (ATOM records): (download)

>d1lxma4 b.30.5.2 (A:620-919) Hyaluronate lyase {Streptococcus agalactiae}
lksnlstfnsmdrlayynakkdfgfalslhskrtlnyegmndentrgwytgdgmfyiyns
dqshysnhfwptvnpykmagttekdakredttkeakektgqvtgtsdfvgsvklndhfal
aamdftnwdrtltaqkgwvilndkivflgsnikntngignvsttidqrkddsktpyttyv
ngktisqqftdtksvfleskepgrnigyiffknstidierkeqtgtwnsinrtskntsiv
snpfitisqkhdsygymmvpnidrtsfdklanskevellens

SCOP Domain Coordinates for d1lxma4:

Click to download the PDB-style file with coordinates for d1lxma4.
(The format of our PDB-style files is described here.)

Timeline for d1lxma4: