Class a: All alpha proteins [46456] (284 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
Protein Troponin C [47503] (6 species) |
Species Human (Homo sapiens), cardiac isoform [TaxId:9606] [47508] (19 PDB entries) |
Domain d1lxfc_: 1lxf C: [78292] Other proteins in same PDB: d1lxfi_ N-domain only; complexed with a troponin I fragment complexed with bep, ca |
PDB Entry: 1lxf (more details)
SCOPe Domain Sequences for d1lxfc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lxfc_ a.39.1.5 (C:) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} mddiykaaveqlteeqknefkaafdifvlgaedgcistkelgkvmrmlgqnptpeelqem idevdedgsgtvdfdeflvmmvrcmkdds
Timeline for d1lxfc_: