Lineage for d1lwwa1 (1lww A:136-325)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1497747Fold a.96: DNA-glycosylase [48149] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 1497748Superfamily a.96.1: DNA-glycosylase [48150] (7 families) (S)
  5. 1497788Family a.96.1.3: DNA repair glycosylase, 2 C-terminal domains [48157] (3 proteins)
  6. 1497829Protein 8-oxoguanine glycosylase [48160] (1 species)
  7. 1497830Species Human (Homo sapiens) [TaxId:9606] [48161] (24 PDB entries)
  8. 1497838Domain d1lwwa1: 1lww A:136-325 [78283]
    Other proteins in same PDB: d1lwwa2
    borohydride trapped intermediate
    protein/DNA complex; complexed with brg, ca

Details for d1lwwa1

PDB Entry: 1lww (more details), 2.1 Å

PDB Description: Borohydride-trapped hOgg1 Intermediate Structure Co-Crystallized with 8-bromoguanine
PDB Compounds: (A:) 8-oxoguanine DNA glycosylase

SCOPe Domain Sequences for d1lwwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lwwa1 a.96.1.3 (A:136-325) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]}
dpieclfsficssnnniaritgmverlcqafgprliqlddvtyhgfpslqalagpeveah
lrklglgyraryvsasaraileeqgglawlqqlressyeeahkalcilpgvgtkvadcic
lmaldkpqavpvdvhmwhiaqrdyswhpttsqakgpspqtnkelgnffrslwgpyagwaq
avlfsadlrq

SCOPe Domain Coordinates for d1lwwa1:

Click to download the PDB-style file with coordinates for d1lwwa1.
(The format of our PDB-style files is described here.)

Timeline for d1lwwa1: