Lineage for d1lwwa1 (1lww A:136-325)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 358646Fold a.96: DNA-glycosylase [48149] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 358647Superfamily a.96.1: DNA-glycosylase [48150] (5 families) (S)
  5. 358678Family a.96.1.3: DNA repair glycosylase, 2 C-terminal domains [48157] (2 proteins)
  6. 358685Protein 8-oxoguanine glycosylase [48160] (1 species)
  7. 358686Species Human (Homo sapiens) [TaxId:9606] [48161] (12 PDB entries)
  8. 358692Domain d1lwwa1: 1lww A:136-325 [78283]
    Other proteins in same PDB: d1lwwa2
    borohydride trapped intermediate
    complexed with brg, ca, ped

Details for d1lwwa1

PDB Entry: 1lww (more details), 2.1 Å

PDB Description: Borohydride-trapped hOgg1 Intermediate Structure Co-Crystallized with 8-bromoguanine

SCOP Domain Sequences for d1lwwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lwwa1 a.96.1.3 (A:136-325) 8-oxoguanine glycosylase {Human (Homo sapiens)}
dpieclfsficssnnniaritgmverlcqafgprliqlddvtyhgfpslqalagpeveah
lrklglgyraryvsasaraileeqgglawlqqlressyeeahkalcilpgvgtkvadcic
lmaldkpqavpvdvhmwhiaqrdyswhpttsqakgpspqtnkelgnffrslwgpyagwaq
avlfsadlrq

SCOP Domain Coordinates for d1lwwa1:

Click to download the PDB-style file with coordinates for d1lwwa1.
(The format of our PDB-style files is described here.)

Timeline for d1lwwa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lwwa2