Lineage for d1lwva1 (1lwv A:136-325)
- Root: SCOP 1.65
Class a: All alpha proteins [46456] (179 folds) 
Fold a.96: DNA-glycosylase [48149] (1 superfamily)
multihelical; consists of two all-alpha domainsSuperfamily a.96.1: DNA-glycosylase [48150] (4 families) 
Family a.96.1.3: DNA repair glycosylase, 2 C-terminal domains [48157] (2 proteins) 
Protein 8-oxoguanine glycosylase [48160] (1 species) Species Human (Homo sapiens) [TaxId:9606] [48161] (10 PDB entries) 
Domain d1lwva1: 1lwv A:136-325 [78281]
Other proteins in same PDB: d1lwva2
borohydride trapped intermediate
complexed with ang, ca, ped
Details for d1lwva1
PDB Entry: 1lwv (more details), 2.3 Å
PDB Description: Borohydride-trapped hOgg1 Intermediate Structure Co-Crystallized with 8-aminoguanine
SCOP Domain Sequences for d1lwva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lwva1 a.96.1.3 (A:136-325) 8-oxoguanine glycosylase {Human (Homo sapiens)}
dpieclfsficssnnniaritgmverlcqafgprliqlddvtyhgfpslqalagpeveah
lrklglgyraryvsasaraileeqgglawlqqlressyeeahkalcilpgvgtkvadcic
lmaldkpqavpvdvhmwhiaqrdyswhpttsqakgpspqtnkelgnffrslwgpyagwaq
avlfsadlrq
SCOP Domain Coordinates for d1lwva1:
Click to download the PDB-style file with coordinates for d1lwva1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1lwva1:
- d1lwva1 first appeared in SCOP 1.63
- d1lwva1 appears in SCOP 1.67
- d1lwva1 appears in the current release, SCOPe 2.08
View in 3D
