Class a: All alpha proteins [46456] (290 folds) |
Fold a.96: DNA-glycosylase [48149] (1 superfamily) multihelical; consists of two all-alpha domains |
Superfamily a.96.1: DNA-glycosylase [48150] (7 families) |
Family a.96.1.3: DNA repair glycosylase, 2 C-terminal domains [48157] (3 proteins) |
Protein 8-oxoguanine glycosylase [48160] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [48161] (24 PDB entries) |
Domain d1lwva1: 1lwv A:136-325 [78281] Other proteins in same PDB: d1lwva2, d1lwva3 borohydride trapped intermediate protein/DNA complex; complexed with ang, ca |
PDB Entry: 1lwv (more details), 2.3 Å
SCOPe Domain Sequences for d1lwva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lwva1 a.96.1.3 (A:136-325) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]} dpieclfsficssnnniaritgmverlcqafgprliqlddvtyhgfpslqalagpeveah lrklglgyraryvsasaraileeqgglawlqqlressyeeahkalcilpgvgtkvadcic lmaldkpqavpvdvhmwhiaqrdyswhpttsqakgpspqtnkelgnffrslwgpyagwaq avlfsadlrq
Timeline for d1lwva1: