SCOP 1.63: Domain d1lw5d_: 1lw5 D:

Lineage for d1lw5d_ (1lw5 D:)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (6 families)

5. Family c.67.1.1: AAT-like [53384] (7 proteins)

6. Protein Low-specificity threonine aldolase [64123] (1 species)

7. Species Thermatoga maritima [64124] (4 PDB entries)

8. Domain d1lw5d_: 1lw5 D: [78261]
   complexed with ca, cl, llp, mse, plg, plp

Details for d1lw5d_

PDB Entry: 1lw5, 2.05 Å

PDB Description: x-ray structure of l-threonine aldolase (low-specificity) in complex with glycine

SCOP Domain Sequences for d1lw5d_:

Sequence; same for both SEQRES and ATOM records:

>d1lw5d_ c.67.1.1 (D:) Low-specificity threonine aldolase {Thermatoga maritima}
mmidlrsdtvtkpteemrkamaqaevgddvygedptinelerlaaetfgkeaalfvpsgt
mgnqvsimahtqrgdevileadshifwyevgamavlsgvmphpvpgkngamdpddvrkai
rprnihfprtsliaienthnrsggrvvplenikeictiakehginvhidgarifnasias
gvpvkeyagyadsvmfclskglcapvgsvvvgdrdfierarkarkmlgggmrqagvlaaa
giialtkmvdrlkedhenarflalklkeigysvnpedvktnmvilrtdnlkvnahgfiea
lrnsgvlanavsdteirlvthkdvsrndieealnifeklfrkfs

Timeline for d1lw5d_:

• d1lw5d_ is new in SCOP 1.63
  
• d1lw5d_ appears in SCOP 1.65
  
• d1lw5d_ appears in the current release, SCOPe 2.08, called d1lw5d1