Lineage for d1lv3a_ (1lv3 A:)

  1. Root: SCOPe 2.02
  2. 1239924Class g: Small proteins [56992] (90 folds)
  3. 1244274Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 1244275Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 1244723Family g.39.1.9: Hypothetical zinc finger protein YacG [82914] (1 protein)
    Zn-binding site is particularly similar to that of ribosomal protein L24e
  6. 1244724Protein Hypothetical zinc finger protein YacG [82915] (1 species)
  7. 1244725Species Escherichia coli [TaxId:562] [82916] (1 PDB entry)
  8. 1244726Domain d1lv3a_: 1lv3 A: [78231]
    complexed with zn

Details for d1lv3a_

PDB Entry: 1lv3 (more details)

PDB Description: solution nmr structure of zinc finger protein yacg from escherichia coli. northeast structural genomics consortium target et92.
PDB Compounds: (A:) HYPOTHETICAL PROTEIN YacG

SCOPe Domain Sequences for d1lv3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lv3a_ g.39.1.9 (A:) Hypothetical zinc finger protein YacG {Escherichia coli [TaxId: 562]}
msetitvncptcgktvvwgeispfrpfcskrcqlidlgewaaeekripssgdlsesddws
eepkq

SCOPe Domain Coordinates for d1lv3a_:

Click to download the PDB-style file with coordinates for d1lv3a_.
(The format of our PDB-style files is described here.)

Timeline for d1lv3a_: