SCOPe 2.08: Domain d1luma1: 1lum A:4-110

Lineage for d1luma1 (1lum A:4-110)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.1: SH2 domain [55551] (35 proteins)
   Pfam PF00017

6. Protein Itk/tsk protein tyrosine kinase [82743] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [82744] (8 PDB entries)

8. Domain d1luma1: 1lum A:4-110 [78228]
   Other proteins in same PDB: d1luma2

Details for d1luma1

PDB Entry: 1lum

PDB Description: nmr structure of the itk sh2 domain, pro287trans, 20 low energy structures

PDB Compounds: (A:) Tyrosine-protein kinase ITK/TSK

SCOPe Domain Sequences for d1luma1:

Sequence; same for both SEQRES and ATOM records:

>d1luma1 d.93.1.1 (A:4-110) Itk/tsk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]}
nnletyewynksisrdkaekllldtgkegafmvrdsrtpgtytvsvftkaiisenpcikh
yhiketndspkryyvaekyvfdsiplliqyhqynggglvtrlrypvc

Timeline for d1luma1:

• d1luma1 first appeared in SCOP 1.63, called d1luma_
  
• d1luma1 appears in SCOPe 2.07