![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
![]() | Superfamily d.93.1: SH2 domain [55550] (2 families) ![]() |
![]() | Family d.93.1.1: SH2 domain [55551] (35 proteins) Pfam PF00017 |
![]() | Protein Itk/tsk protein tyrosine kinase [82743] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [82744] (8 PDB entries) |
![]() | Domain d1luma1: 1lum A:4-110 [78228] Other proteins in same PDB: d1luma2 |
PDB Entry: 1lum (more details)
SCOPe Domain Sequences for d1luma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1luma1 d.93.1.1 (A:4-110) Itk/tsk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} nnletyewynksisrdkaekllldtgkegafmvrdsrtpgtytvsvftkaiisenpcikh yhiketndspkryyvaekyvfdsiplliqyhqynggglvtrlrypvc
Timeline for d1luma1: