SCOP 1.67: Domain d1luka_: 1luk A:

Lineage for d1luka_ (1luk A:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (1 family)

5. Family d.93.1.1: SH2 domain [55551] (28 proteins)

6. Protein Itk/tsk protein tyrosine kinase [82743] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [82744] (4 PDB entries)

8. Domain d1luka_: 1luk A: [78227]
   complexed with ace, nh2

Details for d1luka_

PDB Entry: 1luk

PDB Description: nmr structure of the itk sh2 domain, pro287cis, energy minimized average structure

SCOP Domain Sequences for d1luka_:

Sequence; same for both SEQRES and ATOM records:

>d1luka_ d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mouse (Mus musculus)}
nnletyewynksisrdkaekllldtgkegafmvrdsrtpgtytvsvftkaiisenpcikh
yhiketndspkryyvaekyvfdsiplliqyhqynggglvtrlrypvcg

Timeline for d1luka_:

• d1luka_ first appeared in SCOP 1.63
  
• d1luka_ appears in SCOP 1.65
  
• d1luka_ appears in SCOP 1.69
  
• d1luka_ appears in the current release, SCOPe 2.08, called d1luka1