Lineage for d1lu9c2 (1lu9 C:2-97)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2498096Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2498097Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2498398Family c.58.1.4: Methylene-tetrahydromethanopterin dehydrogenase [82333] (1 protein)
    automatically mapped to Pfam PF09176
  6. 2498399Protein Methylene-tetrahydromethanopterin dehydrogenase [82334] (1 species)
  7. 2498400Species Methylobacterium extorquens [TaxId:408] [82335] (2 PDB entries)
  8. 2498406Domain d1lu9c2: 1lu9 C:2-97 [78215]
    Other proteins in same PDB: d1lu9a1, d1lu9b1, d1lu9c1

Details for d1lu9c2

PDB Entry: 1lu9 (more details), 1.9 Å

PDB Description: Structure of methylene-tetrahydromethanopterin dehydrogenase from Methylobacterium extorquens AM1
PDB Compounds: (C:) Methylene Tetrahydromethanopterin Dehydrogenase

SCOPe Domain Sequences for d1lu9c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lu9c2 c.58.1.4 (C:2-97) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]}
skkllfqfdtdatpsvfdvvvgydggadhitgygnvtpdnvgayvdgtiytrggkekqst
aifvgggdmaagervfeavkkrffgpfrvscmldsn

SCOPe Domain Coordinates for d1lu9c2:

Click to download the PDB-style file with coordinates for d1lu9c2.
(The format of our PDB-style files is described here.)

Timeline for d1lu9c2: