Lineage for d1ltjf2 (1ltj F:110-141)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3039231Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 3039948Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (2 families) (S)
  5. 3039949Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
    in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails
  6. 3040061Protein Fibrinogen gamma chain [88898] (4 species)
  7. 3040070Species Human (Homo sapiens) [TaxId:9606] [88900] (18 PDB entries)
    Uniprot P02679
  8. 3040085Domain d1ltjf2: 1ltj F:110-141 [78207]
    Other proteins in same PDB: d1ltja_, d1ltjb1, d1ltjb2, d1ltjc1, d1ltjd_, d1ltje1, d1ltje2, d1ltjf1
    coiled-coil region only
    complexed with ca

Details for d1ltjf2

PDB Entry: 1ltj (more details), 2.8 Å

PDB Description: crystal structure of recombinant human fibrinogen fragment d with the peptide ligands gly-pro-arg-pro-amide and gly-his-arg-pro-amide
PDB Compounds: (F:) Fibrinogen gamma chain

SCOPe Domain Sequences for d1ltjf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ltjf2 h.1.8.1 (F:110-141) Fibrinogen gamma chain {Human (Homo sapiens) [TaxId: 9606]}
lqeiynsnnqkivnlkekvaqleaqcqepckd

SCOPe Domain Coordinates for d1ltjf2:

Click to download the PDB-style file with coordinates for d1ltjf2.
(The format of our PDB-style files is described here.)

Timeline for d1ltjf2: