Lineage for d1ltjc1 (1ltj C:142-394)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2608754Fold d.171: Fibrinogen C-terminal domain-like [56495] (1 superfamily)
    unusual fold
  4. 2608755Superfamily d.171.1: Fibrinogen C-terminal domain-like [56496] (2 families) (S)
  5. 2608756Family d.171.1.1: Fibrinogen C-terminal domain-like [56497] (2 proteins)
    automatically mapped to Pfam PF00147
  6. 2608757Protein Fibrinogen C-terminal domains [56498] (7 species)
  7. 2608802Species Human (Homo sapiens), gamma [TaxId:9606] [68904] (21 PDB entries)
    Uniprot P02679
  8. 2608819Domain d1ltjc1: 1ltj C:142-394 [78201]
    Other proteins in same PDB: d1ltja_, d1ltjb2, d1ltjc2, d1ltjd_, d1ltje2, d1ltjf2
    complexed with ca

Details for d1ltjc1

PDB Entry: 1ltj (more details), 2.8 Å

PDB Description: crystal structure of recombinant human fibrinogen fragment d with the peptide ligands gly-pro-arg-pro-amide and gly-his-arg-pro-amide
PDB Compounds: (C:) Fibrinogen gamma chain

SCOPe Domain Sequences for d1ltjc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ltjc1 d.171.1.1 (C:142-394) Fibrinogen C-terminal domains {Human (Homo sapiens), gamma [TaxId: 9606]}
tvqihditgkdcqdiankgakqsglyfikplkanqqflvyceidgsgngwtvfqkrldgs
vdfkknwiqykegfghlsptgttefwlgnekihlistqsaipyalrveledwngrtstad
yamfkvgpeadkyrltyayfaggdagdafdgfdfgddpsdkfftshngmqfstwdndndk
fegncaeqdgsgwwmnkchaghlngvyyqggtyskastpngydngiiwatwktrwysmkk
ttmkiipfnrlti

SCOPe Domain Coordinates for d1ltjc1:

Click to download the PDB-style file with coordinates for d1ltjc1.
(The format of our PDB-style files is described here.)

Timeline for d1ltjc1: