SCOPe 2.06: Domain d1lt9c2: 1lt9 C:96-141

Lineage for d1lt9c2 (1lt9 C:96-141)

1. Root: SCOPe 2.06

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (38 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (2 families)

5. Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
   in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails

6. Protein Fibrinogen gamma chain [88898] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88900] (18 PDB entries)
   Uniprot P02679

8. Domain d1lt9c2: 1lt9 C:96-141 [78192]
   Other proteins in same PDB: d1lt9a_, d1lt9b1, d1lt9b2, d1lt9c1, d1lt9d_, d1lt9e1, d1lt9e2, d1lt9f1
   coiled-coil region only
   complexed with ca, nag

Details for d1lt9c2

PDB Entry: 1lt9, 2.8 Å

PDB Description: crystal structure of recombinant human fibrinogen fragment d

PDB Compounds: (C:) Fibrinogen gamma chain

SCOPe Domain Sequences for d1lt9c2:

Sequence; same for both SEQRES and ATOM records:

>d1lt9c2 h.1.8.1 (C:96-141) Fibrinogen gamma chain {Human (Homo sapiens) [TaxId: 9606]}
yeasilthdssirylqeiynsnnqkivnlkekvaqleaqcqepckd

Timeline for d1lt9c2:

• d1lt9c2 first appeared in SCOP 1.63
  
• d1lt9c2 appears in SCOPe 2.05
  
• d1lt9c2 appears in SCOPe 2.07
  
• d1lt9c2 appears in the current release, SCOPe 2.08