Class b: All beta proteins [48724] (149 folds) |
Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily) sandwich; 11 strands in 2 sheets |
Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (1 family) has two smaller insertion domains |
Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (4 proteins) |
Protein Thaumatin [49876] (1 species) |
Species Ketemfe (Thaumatococcus daniellii) [TaxId:4621] [49877] (11 PDB entries) |
Domain d1lr3a_: 1lr3 A: [78157] complexed with tar |
PDB Entry: 1lr3 (more details), 1.8 Å
SCOP Domain Sequences for d1lr3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lr3a_ b.25.1.1 (A:) Thaumatin {Ketemfe (Thaumatococcus daniellii)} atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtnggkiwartdcyfdd sgsgicktgdcggllrckrfgrppttlaefslnqygkdyidisnikgfnvpmnfspttrg crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda fsyvldkpttvtcpgssnyrvtfcpta
Timeline for d1lr3a_: