Lineage for d1lr3a_ (1lr3 A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 459672Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily)
    sandwich; 11 strands in 2 sheets
  4. 459673Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (1 family) (S)
    has two smaller insertion domains
  5. 459674Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (4 proteins)
  6. 459682Protein Thaumatin [49876] (1 species)
  7. 459683Species Ketemfe (Thaumatococcus daniellii) [TaxId:4621] [49877] (11 PDB entries)
  8. 459693Domain d1lr3a_: 1lr3 A: [78157]

Details for d1lr3a_

PDB Entry: 1lr3 (more details), 1.8 Å

PDB Description: Crystal structure of thaumatin at high hydrostatic pressure

SCOP Domain Sequences for d1lr3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lr3a_ b.25.1.1 (A:) Thaumatin {Ketemfe (Thaumatococcus daniellii)}
atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtnggkiwartdcyfdd
sgsgicktgdcggllrckrfgrppttlaefslnqygkdyidisnikgfnvpmnfspttrg
crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda
fsyvldkpttvtcpgssnyrvtfcpta

SCOP Domain Coordinates for d1lr3a_:

Click to download the PDB-style file with coordinates for d1lr3a_.
(The format of our PDB-style files is described here.)

Timeline for d1lr3a_: