SCOPe 2.03: Domain d1lqpa_: 1lqp A:

Lineage for d1lqpa_ (1lqp A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.2: Antibiotic resistance proteins [54598] (8 proteins)
   duplication: consists of two clear structural repeats each having this fold
   subunit fold and dimeric assembly are similar to those of glyoxalase

6. Protein Fosfomycin resistance protein A (FosA) [82630] (2 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [82631] (5 PDB entries)

8. Domain d1lqpa_: 1lqp A: [78151]
   complexed with fcn, k, mn

Details for d1lqpa_

PDB Entry: 1lqp, 1.19 Å

PDB Description: crystal structure of the fosfomycin resistance protein (fosa) containing bound substrate

PDB Compounds: (A:) probable fosfomycin resistance protein

SCOPe Domain Sequences for d1lqpa_:

Sequence; same for both SEQRES and ATOM records:

>d1lqpa_ d.32.1.2 (A:) Fosfomycin resistance protein A (FosA) {Pseudomonas aeruginosa [TaxId: 287]}
mltglnhltlavadlpasiafyrdllgfrlearwdqgaylelgslwlclsrepqyggpaa
dythyafgiaaadfarfaaqlrahgvrewkqnrsegdsfyfldpdghrleahvgdlrsrl
aacrqapyagmrfa

Timeline for d1lqpa_:

• d1lqpa_ first appeared in SCOP 1.63
  
• d1lqpa_ appears in SCOPe 2.02
  
• d1lqpa_ appears in SCOPe 2.04
  
• d1lqpa_ appears in the current release, SCOPe 2.08