Lineage for d1lqpa_ (1lqp A:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 255972Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 255973Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (5 families) (S)
  5. 256002Family d.32.1.2: Antibiotic resistance proteins [54598] (3 proteins)
    duplication: consists of two clear structural repeats each having this fold
    subunit fold and dimeric assembly are similar to those of glyoxalase
  6. 256025Protein Fosfomycin resistance protein A (FosA) [82630] (1 species)
  7. 256026Species Pseudomonas aeruginosa [TaxId:287] [82631] (3 PDB entries)
  8. 256027Domain d1lqpa_: 1lqp A: [78151]

Details for d1lqpa_

PDB Entry: 1lqp (more details), 1.19 Å

PDB Description: crystal structure of the fosfomycin resistance protein (fosa) containing bound substrate

SCOP Domain Sequences for d1lqpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lqpa_ d.32.1.2 (A:) Fosfomycin resistance protein A (FosA) {Pseudomonas aeruginosa}
mltglnhltlavadlpasiafyrdllgfrlearwdqgaylelgslwlclsrepqyggpaa
dythyafgiaaadfarfaaqlrahgvrewkqnrsegdsfyfldpdghrleahvgdlrsrl
aacrqapyagmrfa

SCOP Domain Coordinates for d1lqpa_:

Click to download the PDB-style file with coordinates for d1lqpa_.
(The format of our PDB-style files is described here.)

Timeline for d1lqpa_: