SCOPe 2.07: Domain d1lqmh_: 1lqm H:

Lineage for d1lqmh_ (1lqm H:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.5: Uracil-DNA glycosylase inhibitor protein [54441] (1 family)
   has an additional strand at the C-terminus and a helix inserted after the first strand

5. Family d.17.5.1: Uracil-DNA glycosylase inhibitor protein [54442] (1 protein)

6. Protein Uracil-DNA glycosylase inhibitor protein [54443] (3 species)

7. Species Bacteriophage pbs2 [TaxId:10684] [54445] (12 PDB entries)

8. Domain d1lqmh_: 1lqm H: [78148]
   Other proteins in same PDB: d1lqma_, d1lqmc_, d1lqme_, d1lqmg_
   protein/DNA complex

Details for d1lqmh_

PDB Entry: 1lqm, 3.2 Å

PDB Description: escherichia coli uracil-dna glycosylase complex with uracil-dna glycosylase inhibitor protein

PDB Compounds: (H:) uracil-DNA glycosylase inhibitor

SCOPe Domain Sequences for d1lqmh_:

Sequence; same for both SEQRES and ATOM records:

>d1lqmh_ d.17.5.1 (H:) Uracil-DNA glycosylase inhibitor protein {Bacteriophage pbs2 [TaxId: 10684]}
mtnlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmllts
dapeykpwalviqdsngenkikml

Timeline for d1lqmh_:

• d1lqmh_ first appeared in SCOP 1.63
  
• d1lqmh_ appears in SCOPe 2.06
  
• d1lqmh_ appears in the current release, SCOPe 2.08