Lineage for d1lmia_ (1lmi A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 938285Superfamily b.1.19: Antigen MPT63/MPB63 (immunoprotective extracellular protein) [81982] (1 family) (S)
  5. 938286Family b.1.19.1: Antigen MPT63/MPB63 (immunoprotective extracellular protein) [81983] (1 protein)
  6. 938287Protein Antigen MPT63/MPB63 (immunoprotective extracellular protein) [81984] (1 species)
  7. 938288Species Mycobacterium tuberculosis [TaxId:1773] [81985] (1 PDB entry)
  8. 938289Domain d1lmia_: 1lmi A: [78098]

Details for d1lmia_

PDB Entry: 1lmi (more details), 1.5 Å

PDB Description: 1.5 angstrom resolution crystal structure of a secreted protein from mycobacterium tuberculosis-mpt63
PDB Compounds: (A:) Immunogenic protein MPT63/MPB63

SCOPe Domain Sequences for d1lmia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lmia_ b.1.19.1 (A:) Antigen MPT63/MPB63 (immunoprotective extracellular protein) {Mycobacterium tuberculosis [TaxId: 1773]}
saypitgklgseltmtdtvgqvvlgwkvsdlksstavipgypvagqvweatatvnairgs
vtpavsqfnartadginyrvlwqaagpdtisgatipqgeqstgkiyfdvtgpsptivamn
ngmedlliwep

SCOPe Domain Coordinates for d1lmia_:

Click to download the PDB-style file with coordinates for d1lmia_.
(The format of our PDB-style files is described here.)

Timeline for d1lmia_: