SCOPe 2.01: Domain d1llba_: 1llb A:

Lineage for d1llba_ (1llb A:)

1. Root: SCOPe 2.01

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein AMPC beta-Lactamase, class C [56618] (3 species)
   contains small alpha+beta subdomain inserted in the common fold

7. Species Escherichia coli, cephalosporinase [TaxId:562] [56621] (66 PDB entries)

8. Domain d1llba_: 1llb A: [78092]
   complexed with pcn

Details for d1llba_

PDB Entry: 1llb, 1.72 Å

PDB Description: Crystal Structure Of AmpC beta-Lactamase From E. Coli In Complex With ATMO-penicillin

PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d1llba_:

Sequence; same for both SEQRES and ATOM records:

>d1llba_ e.3.1.1 (A:) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase [TaxId: 562]}
apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq

Timeline for d1llba_:

• d1llba_ first appeared in SCOP 1.63
  
• d1llba_ appears in SCOP 1.75
  
• d1llba_ appears in SCOPe 2.02
  
• d1llba_ appears in the current release, SCOPe 2.08