| Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
| Fold d.110: Profilin-like [55769] (5 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (4 families) ![]() alpha-beta(2)-alpha(2)-beta(3) |
| Family d.110.3.5: N-terminal PAS domain of Pas kinase [82764] (1 protein) |
| Protein N-terminal PAS domain of Pas kinase [82765] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [82766] (1 PDB entry) |
| Domain d1ll8a_: 1ll8 A: [78089] |
PDB Entry: 1ll8 (more details)
SCOP Domain Sequences for d1ll8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ll8a_ d.110.3.5 (A:) N-terminal PAS domain of Pas kinase {Human (Homo sapiens)}
gamdpefnkaiftvdaktteilvandkacgllgyssqdligqkltqfflrsdsdvveals
eehmeadghaavvfgtvvdiisrsgekipvsvwmkrmrqerrlccvvvlepver
Timeline for d1ll8a_: