Lineage for d1lkda1 (1lkd A:2-132)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2942376Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2942377Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2942540Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins)
    duplication: consists of 2 similar domains with 2 repeats in each
    Similar to the Methylmalonyl-CoA epimerase dimer
  6. 2942541Protein 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) [54603] (2 species)
  7. 2942542Species Burkholderia cepacia, formerly Pseudomonas cepacia [TaxId:292] [54605] (6 PDB entries)
  8. 2942543Domain d1lkda1: 1lkd A:2-132 [78059]
    complexed with bp6, fe2, p6g

Details for d1lkda1

PDB Entry: 1lkd (more details), 1.7 Å

PDB Description: crystal structure of 2,3-dihydroxybiphenyl 1,2-dioxygenase (dhbd) complexed with 2',6'-dicl dihydroxybiphenyl (dhb)
PDB Compounds: (A:) biphenyl-2,3-diol 1,2-dioxygenase

SCOPe Domain Sequences for d1lkda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lkda1 d.32.1.3 (A:2-132) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Burkholderia cepacia, formerly Pseudomonas cepacia [TaxId: 292]}
sirslgymgfavsdvaawrsfltqklglmeagttdngdlfridsrawriavqqgevddla
fagyevadaaglaqmadklkqagiavttgdaslarrrgvtglitfadpfglpleiyygas
evfekpflpga

SCOPe Domain Coordinates for d1lkda1:

Click to download the PDB-style file with coordinates for d1lkda1.
(The format of our PDB-style files is described here.)

Timeline for d1lkda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lkda2