Lineage for d1ljmb_ (1ljm B:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 456653Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 456866Superfamily b.2.5: p53-like transcription factors [49417] (7 families) (S)
  5. 456974Family b.2.5.6: RUNT domain [81318] (1 protein)
  6. 456975Protein Acute myeloid leukemia 1 protein (AML1), RUNT domain [49439] (2 species)
    synonym: core binding factor alpha, cbfa
  7. 456976Species Human (Homo sapiens) [TaxId:9606] [49440] (5 PDB entries)
  8. 456978Domain d1ljmb_: 1ljm B: [78052]

Details for d1ljmb_

PDB Entry: 1ljm (more details), 2.5 Å

PDB Description: DNA recognition is mediated by conformational transition and by DNA bending

SCOP Domain Sequences for d1ljmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ljmb_ b.2.5.6 (B:) Acute myeloid leukemia 1 protein (AML1), RUNT domain {Human (Homo sapiens)}
gelvrtdspnflcsvlpthwrcnktlpiafkvvalgdvpdgtlvtvmagndenysaelrn
ataamknqvarfndlrfvgrsgrgksftltitvftnppqvatyhraikitvdgp

SCOP Domain Coordinates for d1ljmb_:

Click to download the PDB-style file with coordinates for d1ljmb_.
(The format of our PDB-style files is described here.)

Timeline for d1ljmb_: