Lineage for d1leea_ (1lee A:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 299835Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 299836Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 300233Family b.50.1.2: Pepsin-like [50646] (9 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 300390Protein Plasmepsin (a hemoglobin-degrading enzyme) [50673] (3 species)
  7. 300391Species Plasmodium falciparum, plasmepsin II [TaxId:5833] [50674] (7 PDB entries)
  8. 300398Domain d1leea_: 1lee A: [77908]
    complexed with r36

Details for d1leea_

PDB Entry: 1lee (more details), 1.9 Å

PDB Description: crystal structure of plasmepsin from p. falciparum in complex with inhibitor rs367

SCOP Domain Sequences for d1leea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1leea_ b.50.1.2 (A:) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium falciparum, plasmepsin II}
lgssndnielvdfqnimfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhly
dssksrtyekdgtkvemnyvsgtvsgffskdlvtvgnlslpykfievidtngfeptytas
tfdgilglgwkdlsigsvdpivvelknqnkienalftfylpvhdkhtgfltiggieerfy
egpltyeklnhdlywqitldahvgnislekancivdsgtsaitvptdflnkmlqnldvik
vpflpfyvtlcnnsklptfeftsengkytlepeyylqhiedvgpglcmlniigldfpvpt
filgdpfmrkyftvfdydnhsvgialakknl

SCOP Domain Coordinates for d1leea_:

Click to download the PDB-style file with coordinates for d1leea_.
(The format of our PDB-style files is described here.)

Timeline for d1leea_: