PDB entry 1lee

View 1lee on RCSB PDB site
Description: crystal structure of plasmepsin from p. falciparum in complex with inhibitor rs367
Deposited on 2002-04-09, released 2002-10-09
The last revision prior to the SCOP 1.65 freeze date was dated 2002-12-04, with a file datestamp of 2002-12-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.236
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1leea_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1leeA (A:)
    lgssndnielvdfqnimfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhly
    dssksrtyekdgtkvemnyvsgtvsgffskdlvtvgnlslpykfievidtngfeptytas
    tfdgilglgwkdlsigsvdpivvelknqnkienalftfylpvhdkhtgfltiggieerfy
    egpltyeklnhdlywqitldahvgnislekancivdsgtsaitvptdflnkmlqnldvik
    vpflpfyvtlcnnsklptfeftsengkytlepeyylqhiedvgpglcmlniigldfpvpt
    filgdpfmrkyftvfdydnhsvgialakknl