SCOPe 2.02: Domain d1ldqa_: 1ldq A:

Lineage for d1ldqa_ (1ldq A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein Avidin [50880] (1 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [50881] (10 PDB entries)

8. Domain d1ldqa_: 1ldq A: [77906]
   complexed with ndg, shm

Details for d1ldqa_

PDB Entry: 1ldq, 2.7 Å

PDB Description: avidin-homobiotin complex

PDB Compounds: (A:) Avidin

SCOPe Domain Sequences for d1ldqa_:

Sequence, based on SEQRES records:

>d1ldqa_ b.61.1.1 (A:) Avidin {Chicken (Gallus gallus) [TaxId: 9031]}
csltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrtqpt
fgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftrl

Sequence, based on observed residues (ATOM records):

>d1ldqa_ b.61.1.1 (A:) Avidin {Chicken (Gallus gallus) [TaxId: 9031]}
csltgkwtndlgsnmtigavnsrgeftgtyttaikesplhgtentinkrtqptfgftvnw
kfsesttvftgqcfidgkevlktmwllrssvndigddwkatrvginiftrl

Timeline for d1ldqa_:

• d1ldqa_ first appeared in SCOP 1.63
  
• d1ldqa_ appears in SCOPe 2.01
  
• d1ldqa_ appears in SCOPe 2.03
  
• d1ldqa_ appears in the current release, SCOPe 2.08