SCOPe 2.04: Domain d1ld4d_: 1ld4 D:

Lineage for d1ld4d_ (1ld4 D:)

1. Root: SCOPe 2.04

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.6: Viruses and virus-receptor complexes [58162] (1 superfamily)

4. Superfamily i.6.1: Viruses and virus-receptor complexes [58163] (1 family)

5. Family i.6.1.1: Viruses and virus-receptor complexes [58164] (12 proteins)

6. Protein Structural proteins [82946] (1 species)

7. Species Sindbis virus [TaxId:11034] [82947] (1 PDB entry)

8. Domain d1ld4d_: 1ld4 D: [77889]
   complexed with unx

Details for d1ld4d_

PDB Entry: 1ld4, 11.4 Å

PDB Description: placement of the structural proteins in sindbis virus

PDB Compounds: (D:) coat protein c

SCOPe Domain Sequences for d1ld4d_:

Sequence; same for both SEQRES and ATOM records:

>d1ld4d_ i.6.1.1 (D:) Structural proteins {Sindbis virus [TaxId: 11034]}
rlfdvknedgdvighalamegkvmkplhvkgtidhpvlsklkftkssaydmefaqlpvnm
rseaftytsehpegfynwhhgavqysggrftiprgvggrgdsgrpimdnsgrvvaivlgg
adegtrtalsvvtwnskgktikttpegteew

Timeline for d1ld4d_:

• d1ld4d_ first appeared in SCOP 1.63
  
• d1ld4d_ appears in SCOPe 2.03
  
• d1ld4d_ appears in SCOPe 2.05
  
• d1ld4d_ appears in the current release, SCOPe 2.08