Lineage for d1ld4c_ (1ld4 C:)

  1. Root: SCOPe 2.07
  2. 2647132Class i: Low resolution protein structures [58117] (25 folds)
  3. 2649079Fold i.6: Viruses and virus-receptor complexes [58162] (1 superfamily)
  4. 2649080Superfamily i.6.1: Viruses and virus-receptor complexes [58163] (1 family) (S)
  5. 2649081Family i.6.1.1: Viruses and virus-receptor complexes [58164] (12 proteins)
  6. 2649226Protein Structural proteins [82946] (1 species)
  7. 2649227Species Sindbis virus [TaxId:11034] [82947] (1 PDB entry)
  8. 2649230Domain d1ld4c_: 1ld4 C: [77888]
    complexed with unx

Details for d1ld4c_

PDB Entry: 1ld4 (more details), 11.4 Å

PDB Description: placement of the structural proteins in sindbis virus
PDB Compounds: (C:) coat protein c

SCOPe Domain Sequences for d1ld4c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ld4c_ i.6.1.1 (C:) Structural proteins {Sindbis virus [TaxId: 11034]}
rlfdvknedgdvighalamegkvmkplhvkgtidhpvlsklkftkssaydmefaqlpvnm
rseaftytsehpegfynwhhgavqysggrftiprgvggrgdsgrpimdnsgrvvaivlgg
adegtrtalsvvtwnskgktikttpegteew

SCOPe Domain Coordinates for d1ld4c_:

Click to download the PDB-style file with coordinates for d1ld4c_.
(The format of our PDB-style files is described here.)

Timeline for d1ld4c_: