![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins) |
![]() | Protein Nitrite reductase, NIR [49551] (5 species) consists of two domains of this fold |
![]() | Species Alcaligenes faecalis, strain s-6 [TaxId:511] [49553] (33 PDB entries) Uniprot P38501 |
![]() | Domain d1l9ta2: 1l9t A:167-339 [77859] complexed with cu, no2 |
PDB Entry: 1l9t (more details), 1.75 Å
SCOPe Domain Sequences for d1l9ta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l9ta2 b.6.1.3 (A:167-339) Nitrite reductase, NIR {Alcaligenes faecalis, strain s-6 [TaxId: 511]} gkaltydkiyyvgeqdfyvprdengkykkyeapgdayedtvkvmrtltpthvvfngavga ltgdkamtaavgekvlivhsqanrdtrphlvgghgdyvwatgkfntppdvdqetwfipgg aagaafytfqqpgiyayvnhnlieafelgaaahfkvtgewnddlmtsvlapsg
Timeline for d1l9ta2:
![]() Domains from other chains: (mouse over for more information) d1l9tb1, d1l9tb2, d1l9tc1, d1l9tc2 |