Lineage for d1l9eb2 (1l9e B:218-321)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1639904Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 1639905Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 1640033Family d.16.1.3: D-aminoacid oxidase-like [54384] (3 proteins)
  6. 1640081Protein Sarcosine oxidase [54388] (1 species)
  7. 1640082Species Bacillus sp., strain b0618 [TaxId:1409] [54389] (16 PDB entries)
  8. 1640094Domain d1l9eb2: 1l9e B:218-321 [77826]
    Other proteins in same PDB: d1l9ea1, d1l9eb1
    complexed with cl, fad, imd

Details for d1l9eb2

PDB Entry: 1l9e (more details), 1.85 Å

PDB Description: role of histidine 269 in catalysis by monomeric sarcosine oxidase
PDB Compounds: (B:) Monomeric sarcosine oxidase

SCOPe Domain Sequences for d1l9eb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l9eb2 d.16.1.3 (B:218-321) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]}
lqpyrqvvgffesdeskysndidfpgfmvevpngiyygfpsfggcglklgyhtfgqkidp
dtinrefgvypedesnlrafleeympgangelkrgavcmytktl

SCOPe Domain Coordinates for d1l9eb2:

Click to download the PDB-style file with coordinates for d1l9eb2.
(The format of our PDB-style files is described here.)

Timeline for d1l9eb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1l9eb1