Lineage for d1l6za2 (1l6z A:108-203)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 787055Family b.1.1.4: I set domains [49159] (38 proteins)
  6. 787065Protein Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-terminal domain [81956] (1 species)
  7. 787066Species Mouse (Mus musculus) [TaxId:10090] [81957] (1 PDB entry)
  8. 787067Domain d1l6za2: 1l6z A:108-203 [77771]
    Other proteins in same PDB: d1l6za1
    complexed with man, nag

Details for d1l6za2

PDB Entry: 1l6z (more details), 3.32 Å

PDB Description: crystal structure of murine ceacam1a[1,4]: a coronavirus receptor and cell adhesion molecule in the cea family
PDB Compounds: (A:) biliary glycoprotein C

SCOP Domain Sequences for d1l6za2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l6za2 b.1.1.4 (A:108-203) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
qpvtqpflqvtnttvkeldsvtltclsndiganiqwlfnsqslqltermtlsqnnsilri
dpikredageyqceisnpvsvrrsnsikldiifdps

SCOP Domain Coordinates for d1l6za2:

Click to download the PDB-style file with coordinates for d1l6za2.
(The format of our PDB-style files is described here.)

Timeline for d1l6za2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1l6za1