Lineage for d1l6lk_ (1l6l K:)

  1. Root: SCOP 1.63
  2. 271841Class h: Coiled coil proteins [57942] (6 folds)
  3. 272747Fold h.6: Apolipoprotein A-II [82935] (1 superfamily)
    segmented tetrameric parallel coiled coil
  4. 272748Superfamily h.6.1: Apolipoprotein A-II [82936] (1 family) (S)
  5. 272749Family h.6.1.1: Apolipoprotein A-II [82937] (1 protein)
  6. 272750Protein Apolipoprotein A-II [82938] (1 species)
  7. 272751Species Human (Homo sapiens) [TaxId:9606] [82939] (2 PDB entries)
  8. 272782Domain d1l6lk_: 1l6l K: [77754]

Details for d1l6lk_

PDB Entry: 1l6l (more details), 2.3 Å

PDB Description: structures of apolipoprotein a-ii and a lipid surrogate complex provide insights into apolipoprotein-lipid interactions

SCOP Domain Sequences for d1l6lk_:

Sequence, based on SEQRES records: (download)

>d1l6lk_ h.6.1.1 (K:) Apolipoprotein A-II {Human (Homo sapiens)}
akepcveslvsqyfqtvtdygkdlmekvkspelqaeaksyfekskeqltplikkagtelv
nflsyfvelgtqpatq

Sequence, based on observed residues (ATOM records): (download)

>d1l6lk_ h.6.1.1 (K:) Apolipoprotein A-II {Human (Homo sapiens)}
akepcveslvsqyfqtvtdygkdlmekvkspelqaksyfekskeqltplikkagtelvnf
lsyfvelgtqpatq

SCOP Domain Coordinates for d1l6lk_:

Click to download the PDB-style file with coordinates for d1l6lk_.
(The format of our PDB-style files is described here.)

Timeline for d1l6lk_: