Lineage for d1l5na_ (1l5n A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1598645Fold c.39: Nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (CobT) [52732] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 3214567
  4. 1598646Superfamily c.39.1: Nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (CobT) [52733] (2 families) (S)
  5. 1598647Family c.39.1.1: Nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (CobT) [52734] (2 proteins)
    automatically mapped to Pfam PF02277
  6. 1598648Protein Nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (CobT) [52735] (2 species)
  7. 1598649Species Salmonella typhimurium [TaxId:90371] [52736] (28 PDB entries)
  8. 1598653Domain d1l5na_: 1l5n A: [77710]
    complexed with imd, po4

Details for d1l5na_

PDB Entry: 1l5n (more details), 1.9 Å

PDB Description: Crystal Structure of CobT complexed with imidazole
PDB Compounds: (A:) Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase

SCOPe Domain Sequences for d1l5na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l5na_ c.39.1.1 (A:) Nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (CobT) {Salmonella typhimurium [TaxId: 90371]}
lhallrdipapdaeamartqqhidgllkppgslgrletlavqlagmpglngtpqvgekav
lvmcadhgvwdegvavspkivtaiqaanmtrgttgvcvlaaqagakvhvidvgidaepip
gvvnmrvargcgniavgpamsrlqaealllevsrytcdlaqrgvtlfgvgelgmanttpa
aamvsvftgsdakevvgiganlppsridnkvdvvrraiainqpnprdgidvlskvggfdl
vgmtgvmlgaarcglpvlldgflsysaalaacqiapavrpylipshfsaekgarialahl
smepylhmamrlgegsgaalampiveaacamfhnmgelaasnivlp

SCOPe Domain Coordinates for d1l5na_:

Click to download the PDB-style file with coordinates for d1l5na_.
(The format of our PDB-style files is described here.)

Timeline for d1l5na_: