Lineage for d1l4la_ (1l4l A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 990677Fold c.39: Nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (CobT) [52732] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 3214567
  4. 990678Superfamily c.39.1: Nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (CobT) [52733] (1 family) (S)
  5. 990679Family c.39.1.1: Nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (CobT) [52734] (2 proteins)
  6. 990680Protein Nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (CobT) [52735] (2 species)
  7. 990681Species Salmonella typhimurium [TaxId:90371] [52736] (28 PDB entries)
  8. 990689Domain d1l4la_: 1l4l A: [77690]
    complexed with ncn, xyd

Details for d1l4la_

PDB Entry: 1l4l (more details), 2 Å

PDB Description: crystal structure of cobt complexed with 2,5-dimethylaniline and nicotinate mononucleotide
PDB Compounds: (A:) Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase

SCOPe Domain Sequences for d1l4la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l4la_ c.39.1.1 (A:) Nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (CobT) {Salmonella typhimurium [TaxId: 90371]}
tlhallrdipapdaeamartqqhidgllkppgslgrletlavqlagmpglngtpqvgeka
vlvmcadhgvwdegvavspkivtaiqaanmtrgttgvcvlaaqagakvhvidvgidaepi
pgvvnmrvargcgniavgpamsrlqaealllevsrytcdlaqrgvtlfgvgelgmanttp
aaamvsvftgsdakevvgiganlppsridnkvdvvrraiainqpnprdgidvlskvggfd
lvgmtgvmlgaarcglpvlldgflsysaalaacqiapavrpylipshfsaekgarialah
lsmepylhmamrlgegsgaalampiveaacamfhnmgelaasnivlp

SCOPe Domain Coordinates for d1l4la_:

Click to download the PDB-style file with coordinates for d1l4la_.
(The format of our PDB-style files is described here.)

Timeline for d1l4la_: