SCOP 1.73: Domain d1l4da_: 1l4d A:

Lineage for d1l4da_ (1l4d A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)

6. Protein Plasmin(ogen), catalytic domain [50588] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50589] (7 PDB entries)

8. Domain d1l4da_: 1l4d A: [77683]
   Other proteins in same PDB: d1l4db_
   microplasminogen
   complexed with so4; mutant

Details for d1l4da_

PDB Entry: 1l4d, 2.3 Å

PDB Description: crystal structure of microplasminogen-streptokinase alpha domain complex

PDB Compounds: (A:) plasminogen

SCOP Domain Sequences for d1l4da_:

Sequence; same for both SEQRES and ATOM records:

>d1l4da_ b.47.1.2 (A:) Plasmin(ogen), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
apsfdcgkpqvepkkcpgrvvggcvahphswpwqvslrtrfgmhfcggtlispewvltaa
hcleksprpssykvilgahqevnlephvqeievsrlfleptrkdiallklsspavitdkv
ipaclpspnyvvadrtecfitgwgetqgtfgagllkeaqlpvienkvcnryeflngrvqs
telcaghlaggtdscqgdaggplvcfekdkyilqgvtswglgcarpnkpgvyvrvsrfvt
wiegvmrnn

Timeline for d1l4da_:

• d1l4da_ first appeared in SCOP 1.63
  
• d1l4da_ appears in SCOP 1.71
  
• d1l4da_ appears in SCOP 1.75
  
• d1l4da_ appears in the current release, SCOPe 2.08