SCOPe 2.06: Domain d1l1qa1: 1l1q A:2-180

Lineage for d1l1qa1 (1l1q A:2-180)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)

6. Protein Adenine PRTase [53288] (5 species)

7. Species Giardia intestinalis [TaxId:5741] [82455] (2 PDB entries)

8. Domain d1l1qa1: 1l1q A:2-180 [77653]
   Other proteins in same PDB: d1l1qa2
   complexed with 9da, so4

Details for d1l1qa1

PDB Entry: 1l1q, 1.85 Å

PDB Description: Crystal Structure of APRTase from Giardia lamblia Complexed with 9-deazaadenine

PDB Compounds: (A:) Adenine phosphoribosyltransferase

SCOPe Domain Sequences for d1l1qa1:

Sequence; same for both SEQRES and ATOM records:

>d1l1qa1 c.61.1.1 (A:2-180) Adenine PRTase {Giardia intestinalis [TaxId: 5741]}
tmsvadahaliktipdfptkgiafkdlsdilstpaaldavrkevtahykdvpitkvvgie
srgfilggivanslgvgfvalrkagklpgdvckctfdmeyqkgvtievqkrqlgphdvvl
lhddvlatggtllaaielcetagvkpeniyinvlyeiealkgrekvgqkctrlfsvire

Timeline for d1l1qa1:

• d1l1qa1 first appeared in SCOP 1.63, called d1l1qa_
  
• d1l1qa1 was called d1l1qa_ in SCOPe 2.05
  
• d1l1qa1 appears in SCOPe 2.07
  
• d1l1qa1 appears in the current release, SCOPe 2.08