Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.61.1: PRTase-like [53271] (3 families) |
Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins) |
Protein Adenine PRTase [53288] (5 species) |
Species Giardia intestinalis [TaxId:5741] [82455] (2 PDB entries) |
Domain d1l1qa1: 1l1q A:2-180 [77653] Other proteins in same PDB: d1l1qa2 complexed with 9da, so4 |
PDB Entry: 1l1q (more details), 1.85 Å
SCOPe Domain Sequences for d1l1qa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l1qa1 c.61.1.1 (A:2-180) Adenine PRTase {Giardia intestinalis [TaxId: 5741]} tmsvadahaliktipdfptkgiafkdlsdilstpaaldavrkevtahykdvpitkvvgie srgfilggivanslgvgfvalrkagklpgdvckctfdmeyqkgvtievqkrqlgphdvvl lhddvlatggtllaaielcetagvkpeniyinvlyeiealkgrekvgqkctrlfsvire
Timeline for d1l1qa1: