Lineage for d1kx3a_ (1kx3 A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1082620Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1082621Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 1082622Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 1082815Protein Histone H3 [47122] (6 species)
  7. 1082816Species African clawed frog (Xenopus laevis) [TaxId:8355] [47124] (39 PDB entries)
  8. 1082821Domain d1kx3a_: 1kx3 A: [77577]
    Other proteins in same PDB: d1kx3b_, d1kx3c_, d1kx3d_, d1kx3f_, d1kx3g_, d1kx3h_
    protein/DNA complex; complexed with mn

Details for d1kx3a_

PDB Entry: 1kx3 (more details), 2 Å

PDB Description: X-Ray Structure of the Nucleosome Core Particle, NCP146, at 2.0 A Resolution
PDB Compounds: (A:) histone h3

SCOPe Domain Sequences for d1kx3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kx3a_ a.22.1.1 (A:) Histone H3 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqease
aylvalfedtnlcaihakrvtimpkdiqlarrirgera

SCOPe Domain Coordinates for d1kx3a_:

Click to download the PDB-style file with coordinates for d1kx3a_.
(The format of our PDB-style files is described here.)

Timeline for d1kx3a_: