Lineage for d1kmtb1 (1kmt B:67-202)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2375023Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2375554Family b.1.18.8: RhoGDI-like [81288] (3 proteins)
  6. 2375588Protein Rho GDP-dissociation inhibitor 1, RhoGDI [49241] (3 species)
  7. 2375593Species Human (Homo sapiens) [TaxId:9606] [49242] (12 PDB entries)
  8. 2375595Domain d1kmtb1: 1kmt B:67-202 [77443]
    Other proteins in same PDB: d1kmta2, d1kmtb2
    mutant

Details for d1kmtb1

PDB Entry: 1kmt (more details), 1.3 Å

PDB Description: crystal structure of rhogdi glu(154,155)ala mutant
PDB Compounds: (B:) rho GDP-dissociation inhibitor 1

SCOPe Domain Sequences for d1kmtb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kmtb1 b.1.18.8 (B:67-202) Rho GDP-dissociation inhibitor 1, RhoGDI {Human (Homo sapiens) [TaxId: 9606]}
vpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivsgm
kyiqhtyrkgvkidktdymvgsygpraaayefltpveeapkgmlargsysiksrftdddk
tdhlswewnltikkdw

SCOPe Domain Coordinates for d1kmtb1:

Click to download the PDB-style file with coordinates for d1kmtb1.
(The format of our PDB-style files is described here.)

Timeline for d1kmtb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kmtb2