SCOP 1.69: Domain d1kf9b1: 1kf9 B:233-328

Lineage for d1kf9b1 (1kf9 B:233-328)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (24 proteins)

6. Protein Growth hormone receptor [49280] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49281] (6 PDB entries)
   tandem of fibronectin type III domains

8. Domain d1kf9b1: 1kf9 B:233-328 [77352]
   Other proteins in same PDB: d1kf9a_, d1kf9d_

Details for d1kf9b1

PDB Entry: 1kf9, 2.6 Å

PDB Description: phage display derived variant of human growth hormone complexed with two copies of the extracellular domain of its receptor

SCOP Domain Sequences for d1kf9b1:

Sequence, based on SEQRES records:

>d1kf9b1 b.1.2.1 (B:233-328) Growth hormone receptor {Human (Homo sapiens)}
pkftkcrsperetfschwtdevhhgtknlgpiqlfytrrntqewtqewkecpdyvsagen
scyfnssftsiwipycikltsnggtvdekcfsvdei

Sequence, based on observed residues (ATOM records):

>d1kf9b1 b.1.2.1 (B:233-328) Growth hormone receptor {Human (Homo sapiens)}
pkftkcrsperetfschwtpiqlfytrrntqewtqewkecpdyvsagenscyfnssftsi
wipycikltsnggtvdekcfsvdei

Timeline for d1kf9b1:

• d1kf9b1 first appeared in SCOP 1.63
  
• d1kf9b1 appears in SCOP 1.67
  
• d1kf9b1 appears in SCOP 1.71
  
• d1kf9b1 appears in the current release, SCOPe 2.08