SCOPe 2.03: Domain d1ka9h_: 1ka9 H:

Lineage for d1ka9h_ (1ka9 H:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 proteins)
   contains a catalytic Cys-His-Glu triad

6. Protein GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF [69447] (3 species)

7. Species Thermus thermophilus [TaxId:274] [82350] (1 PDB entry)

8. Domain d1ka9h_: 1ka9 H: [77308]
   Other proteins in same PDB: d1ka9f_

Details for d1ka9h_

PDB Entry: 1ka9, 2.3 Å

PDB Description: imidazole glycerol phosphate synthase

PDB Compounds: (H:) imidazole glycerol phosphtate synthase

SCOPe Domain Sequences for d1ka9h_:

Sequence; same for both SEQRES and ATOM records:

>d1ka9h_ c.23.16.1 (H:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]}
mkallidygsgnlrsaakaleaagfsvavaqdpkaheeadllvlpgqghfgqvmrafqes
gfvervrrhlerglpflgicvgmqvlyegseeapgvrglglvpgevrrfragrvpqmgwn
alefggafapltgrhfyfansyygpltpyslgkgeyegtpftallakenllapqfhpeks
gkaglaflalarryf

Timeline for d1ka9h_:

• d1ka9h_ first appeared in SCOP 1.63
  
• d1ka9h_ appears in SCOPe 2.02
  
• d1ka9h_ appears in SCOPe 2.04
  
• d1ka9h_ appears in the current release, SCOPe 2.08