![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) ![]() |
![]() | Family c.1.2.1: Histidine biosynthesis enzymes [51367] (3 proteins) structural evidence for the gene duplication within the barrel fold automatically mapped to Pfam PF00977 |
![]() | Protein Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF [51370] (4 species) |
![]() | Species Thermus thermophilus [TaxId:274] [82237] (1 PDB entry) |
![]() | Domain d1ka9f_: 1ka9 F: [77307] Other proteins in same PDB: d1ka9h_ |
PDB Entry: 1ka9 (more details), 2.3 Å
SCOPe Domain Sequences for d1ka9f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ka9f_ c.1.2.1 (F:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} slakrivpcldvhagrvvkgvnfvnlrdagdpveaaraydeagadelvfldisatheera illdvvarvaervfipltvgggvrsledarklllsgadkvsvnsaavrrpelireladhf gaqavvlaidarwrgdfpevhvaggrvptglhavewavkgvelgageilltsmdrdgtke gydlrltrmvaeavgvpviasggagrmehfleafqagaeaalaasvfhfgeipipklkry laekgvhvrld
Timeline for d1ka9f_: