Lineage for d1ka9f_ (1ka9 F:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1337250Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 1337251Family c.1.2.1: Histidine biosynthesis enzymes [51367] (3 proteins)
    structural evidence for the gene duplication within the barrel fold
    automatically mapped to Pfam PF00977
  6. 1337252Protein Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF [51370] (4 species)
  7. 1337274Species Thermus thermophilus [TaxId:274] [82237] (1 PDB entry)
  8. 1337275Domain d1ka9f_: 1ka9 F: [77307]
    Other proteins in same PDB: d1ka9h_

Details for d1ka9f_

PDB Entry: 1ka9 (more details), 2.3 Å

PDB Description: imidazole glycerol phosphate synthase
PDB Compounds: (F:) imidazole glycerol phosphtate synthase

SCOPe Domain Sequences for d1ka9f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ka9f_ c.1.2.1 (F:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]}
slakrivpcldvhagrvvkgvnfvnlrdagdpveaaraydeagadelvfldisatheera
illdvvarvaervfipltvgggvrsledarklllsgadkvsvnsaavrrpelireladhf
gaqavvlaidarwrgdfpevhvaggrvptglhavewavkgvelgageilltsmdrdgtke
gydlrltrmvaeavgvpviasggagrmehfleafqagaeaalaasvfhfgeipipklkry
laekgvhvrld

SCOPe Domain Coordinates for d1ka9f_:

Click to download the PDB-style file with coordinates for d1ka9f_.
(The format of our PDB-style files is described here.)

Timeline for d1ka9f_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ka9h_