Lineage for d1k3yb2 (1k3y B:2-80)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1368269Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1368270Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1368661Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 1368672Protein Class alpha GST [81360] (8 species)
  7. 1368687Species Human (Homo sapiens), (a1-1) [TaxId:9606] [52870] (28 PDB entries)
    Uniprot P08263
  8. 1368689Domain d1k3yb2: 1k3y B:2-80 [77248]
    Other proteins in same PDB: d1k3ya1, d1k3yb1
    complexed with gol, gtx

Details for d1k3yb2

PDB Entry: 1k3y (more details), 1.3 Å

PDB Description: crystal structure analysis of human glutathione s-transferase with s- hexyl glutatione and glycerol at 1.3 angstrom
PDB Compounds: (B:) glutathione s-transferase a1

SCOPe Domain Sequences for d1k3yb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k3yb2 c.47.1.5 (B:2-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
aekpklhyfnargrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
gmklvqtrailnyiaskyn

SCOPe Domain Coordinates for d1k3yb2:

Click to download the PDB-style file with coordinates for d1k3yb2.
(The format of our PDB-style files is described here.)

Timeline for d1k3yb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1k3yb1