| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) |
| Protein Class alpha GST [81360] (8 species) |
| Species Human (Homo sapiens), (a1-1) [TaxId:9606] [52870] (28 PDB entries) Uniprot P08263 |
| Domain d1k3ya2: 1k3y A:2-80 [77246] Other proteins in same PDB: d1k3ya1, d1k3yb1 complexed with gol, gtx |
PDB Entry: 1k3y (more details), 1.3 Å
SCOPe Domain Sequences for d1k3ya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k3ya2 c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
aekpklhyfnargrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
gmklvqtrailnyiaskyn
Timeline for d1k3ya2: