SCOP 1.63: Domain d1k3yb1: 1k3y B:81-222

Lineage for d1k3yb1 (1k3y B:81-222)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (15 proteins)

6. Protein Class alpha GST [81349] (6 species)

7. Species Human (Homo sapiens), (a1-1) [TaxId:9606] [47625] (10 PDB entries)

8. Domain d1k3yb1: 1k3y B:81-222 [77247]
   Other proteins in same PDB: d1k3ya2, d1k3yb2
   complexed with gol, gtx

Details for d1k3yb1

PDB Entry: 1k3y, 1.3 Å

PDB Description: crystal structure analysis of human glutathione s-transferase with s- hexyl glutatione and glycerol at 1.3 angstrom

SCOP Domain Sequences for d1k3yb1:

Sequence; same for both SEQRES and ATOM records:

>d1k3yb1 a.45.1.1 (B:81-222) Class alpha GST {Human (Homo sapiens), (a1-1)}
lygkdikeralidmyiegiadlgemilllpvcppeekdaklalikekiknryfpafekvl
kshgqdylvgnklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqp
gsprkppmdeksleearkifrf

Timeline for d1k3yb1:

• d1k3yb1 is new in SCOP 1.63
  
• d1k3yb1 appears in SCOP 1.65
  
• d1k3yb1 appears in the current release, SCOPe 2.08