Lineage for d1k3wa3 (1k3w A:223-262)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1065411Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 1065412Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 1065817Family g.39.1.8: C-terminal, Zn-finger domain of MutM-like DNA repair proteins [81627] (3 proteins)
  6. 1065846Protein Endonuclease VIII [82917] (1 species)
  7. 1065847Species Escherichia coli [TaxId:562] [82918] (8 PDB entries)
    Uniprot P50465
  8. 1065850Domain d1k3wa3: 1k3w A:223-262 [77241]
    Other proteins in same PDB: d1k3wa1, d1k3wa2
    complexed with so4, zn

Details for d1k3wa3

PDB Entry: 1k3w (more details), 1.42 Å

PDB Description: crystal structure of a trapped reaction intermediate of the dna repair enzyme endonuclease viii with dna
PDB Compounds: (A:) Endonuclease VIII

SCOPe Domain Sequences for d1k3wa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k3wa3 g.39.1.8 (A:223-262) Endonuclease VIII {Escherichia coli [TaxId: 562]}
alfrfkvfhrdgepcercgsiiekttlssrpfywcpgcqh

SCOPe Domain Coordinates for d1k3wa3:

Click to download the PDB-style file with coordinates for d1k3wa3.
(The format of our PDB-style files is described here.)

Timeline for d1k3wa3: