Lineage for d1k0wf_ (1k0w F:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2512903Fold c.74: AraD/HMP-PK domain-like [53638] (1 superfamily)
    3 layers: a/b/a; mixed (mostly antiparallel) beta-sheet of 9 strands, order 432159876; left-handed crossover between strands 4 and 5
  4. 2512904Superfamily c.74.1: AraD/HMP-PK domain-like [53639] (3 families) (S)
  5. 2512905Family c.74.1.1: AraD-like aldolase/epimerase [53640] (5 proteins)
    metal (zinc)-ion dependent
  6. 2512963Protein L-ribulose-5-phosphate 4-epimerase [69597] (1 species)
  7. 2512964Species Escherichia coli [TaxId:562] [69598] (2 PDB entries)
  8. 2512970Domain d1k0wf_: 1k0w F: [77225]
    complexed with zn

Details for d1k0wf_

PDB Entry: 1k0w (more details), 2.1 Å

PDB Description: crystal structure of l-ribulose-5-phosphate 4-epimerase
PDB Compounds: (F:) l-ribulose 5 phosphate 4-epimerase

SCOPe Domain Sequences for d1k0wf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k0wf_ c.74.1.1 (F:) L-ribulose-5-phosphate 4-epimerase {Escherichia coli [TaxId: 562]}
mledlkrqvleanlalpkhnlvtltwgnvsavdrergvfvikpsgvdysimtaddmvvvs
ietgevvegakkpssdtpthrllyqafpsiggivhthsrhatiwaqagqsipatgtthan
yfygtipctrkmtdaeingeyewetgnvivetfekqgidaaqmpgvlvhshgpfawgkna
edavhnaivleevaymgifcrqlapqlpdmqqtllnkhylrkh

SCOPe Domain Coordinates for d1k0wf_:

Click to download the PDB-style file with coordinates for d1k0wf_.
(The format of our PDB-style files is described here.)

Timeline for d1k0wf_: