Lineage for d1k07a_ (1k07 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2996664Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2996665Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) (S)
  5. 2996666Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 2996667Protein Zn metallo-beta-lactamase [56283] (14 species)
  7. 2996750Species Fluoribacter gormanii, (Legionella gormanii) FEZ-1 [TaxId:464] [82802] (5 PDB entries)
  8. 2996751Domain d1k07a_: 1k07 A: [77218]
    complexed with act, gol, so4, zn

Details for d1k07a_

PDB Entry: 1k07 (more details), 1.65 Å

PDB Description: Native FEZ-1 metallo-beta-lactamase from Legionella gormanii
PDB Compounds: (A:) FEZ-1 beta-lactamase

SCOPe Domain Sequences for d1k07a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k07a_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Fluoribacter gormanii, (Legionella gormanii) FEZ-1 [TaxId: 464]}
ypmpnpfppfriagnlyyvgtddlasylivtprgnilinsdleanvpmikasikklgfkf
sdtkillishahfdhaagselikqqtkakymvmdedvsvilsggksdfhyandsstyftq
stvdkvlhdgervelggtvltahltpghtrgcttwtmklkdhgkqyqaviigsigvnpgy
klvdnitypkiaedykhsikvlesmrcdiflgshagmfdlknkyvllskgqnnpfvdptg
cknyieqkandfytelkkqetg

SCOPe Domain Coordinates for d1k07a_:

Click to download the PDB-style file with coordinates for d1k07a_.
(The format of our PDB-style files is described here.)

Timeline for d1k07a_: