SCOPe 2.01: Domain d1jqqa_: 1jqq A:

Lineage for d1jqqa_ (1jqq A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein Peroxisomal membrane protein Pex13p [82055] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82056] (3 PDB entries)

8. Domain d1jqqa_: 1jqq A: [77164]

Details for d1jqqa_

PDB Entry: 1jqq, 2.65 Å

PDB Description: Crystal structure of Pex13p(301-386) SH3 domain

PDB Compounds: (A:) peroxisomal membrane protein pas20

SCOPe Domain Sequences for d1jqqa_:

Sequence; same for both SEQRES and ATOM records:

>d1jqqa_ b.34.2.1 (A:) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
isefgsepidpsklefaralydfvpenpemevalkkgdlmailskkdplgrdsdwwkvrt
kngnigyipynyieiikrr

Timeline for d1jqqa_:

• d1jqqa_ first appeared in SCOP 1.63
  
• d1jqqa_ appears in SCOP 1.75
  
• d1jqqa_ appears in SCOPe 2.02
  
• d1jqqa_ appears in the current release, SCOPe 2.08, called d1jqqa1